Protein Description: pleckstrin homology-like domain, family A, member 1
Gene Name: PHLDA1
Alternative Gene Name: DT1P1B11, PHRIP, TDAG51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020205: 98%, ENSRNOG00000004019: 100%
Entrez Gene ID: 22822
Uniprot ID: Q8WV24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHLDA1
Alternative Gene Name: DT1P1B11, PHRIP, TDAG51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020205: 98%, ENSRNOG00000004019: 100%
Entrez Gene ID: 22822
Uniprot ID: Q8WV24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQP |
Documents & Links for Anti PHLDA1 pAb (ATL-HPA063520) | |
Datasheet | Anti PHLDA1 pAb (ATL-HPA063520) Datasheet (External Link) |
Vendor Page | Anti PHLDA1 pAb (ATL-HPA063520) at Atlas |
Documents & Links for Anti PHLDA1 pAb (ATL-HPA063520) | |
Datasheet | Anti PHLDA1 pAb (ATL-HPA063520) Datasheet (External Link) |
Vendor Page | Anti PHLDA1 pAb (ATL-HPA063520) |