Anti PHLDA1 pAb (ATL-HPA063520)

Atlas Antibodies

Catalog No: ATL-HPA063520-25

• 

Product Description

Protein Description: pleckstrin homology-like domain, family A, member 1
Gene Name: PHLDA1
Alternative Gene Name: DT1P1B11, PHRIP, TDAG51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020205: 98%, ENSRNOG00000004019: 100%
Entrez Gene ID: 22822
Uniprot ID: Q8WV24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQP
• Gene Sequence: KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQP
• Gene ID - Mouse: ENSMUSG00000020205
• Gene ID - Rat: ENSRNOG00000004019
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.