Description
Product Description
Protein Description: phosphorylase kinase regulatory subunit alpha 1
Gene Name: PHKA1
Alternative Gene Name: PHKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034055: 86%, ENSRNOG00000003063: 88%
Entrez Gene ID: 5255
Uniprot ID: P46020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHKA1
Alternative Gene Name: PHKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034055: 86%, ENSRNOG00000003063: 88%
Entrez Gene ID: 5255
Uniprot ID: P46020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWG |
Gene Sequence | VPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWG |
Gene ID - Mouse | ENSMUSG00000034055 |
Gene ID - Rat | ENSRNOG00000003063 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PHKA1 pAb (ATL-HPA075355 w/enhanced validation) | |
Datasheet | Anti PHKA1 pAb (ATL-HPA075355 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PHKA1 pAb (ATL-HPA075355 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PHKA1 pAb (ATL-HPA075355 w/enhanced validation) | |
Datasheet | Anti PHKA1 pAb (ATL-HPA075355 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PHKA1 pAb (ATL-HPA075355 w/enhanced validation) |