Anti PHF8 pAb (ATL-HPA062015)

Atlas Antibodies

Catalog No: ATL-HPA062015-25

• 

Product Description

Protein Description: PHD finger protein 8
Gene Name: PHF8
Alternative Gene Name: JHDM1F, KIAA1111, ZNF422
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041229: 93%, ENSRNOG00000002708: 92%
Entrez Gene ID: 23133
Uniprot ID: Q9UPP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQ
• Gene Sequence: KATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQ
• Gene ID - Mouse: ENSMUSG00000041229
• Gene ID - Rat: ENSRNOG00000002708
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.