Protein Description: phosphoglucomutase 5
Gene Name: PGM5
Alternative Gene Name: PGMRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041731: 94%, ENSRNOG00000015406: 89%
Entrez Gene ID: 5239
Uniprot ID: Q15124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PGM5
Alternative Gene Name: PGMRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041731: 94%, ENSRNOG00000015406: 89%
Entrez Gene ID: 5239
Uniprot ID: Q15124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KDGLWAVLVWLSIIAARKQSVEEIVRDHWAKFGRHYYCRFDYEGLDPKTTYYIMRDLEALVTDKSFIGQQFAVGSHVYSVAKTDS |
| Documents & Links for Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation) | |
| Datasheet | Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation) at Atlas |
| Documents & Links for Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation) | |
| Datasheet | Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation) |