Description
Product Description
Protein Description: peptidoglycan recognition protein 1
Gene Name: PGLYRP1
Alternative Gene Name: PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030413: 72%, ENSRNOG00000013395: 72%
Entrez Gene ID: 8993
Uniprot ID: O75594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PGLYRP1
Alternative Gene Name: PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030413: 72%, ENSRNOG00000013395: 72%
Entrez Gene ID: 8993
Uniprot ID: O75594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNF |
Gene Sequence | VPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNF |
Gene ID - Mouse | ENSMUSG00000030413 |
Gene ID - Rat | ENSRNOG00000013395 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PGLYRP1 pAb (ATL-HPA070227) | |
Datasheet | Anti PGLYRP1 pAb (ATL-HPA070227) Datasheet (External Link) |
Vendor Page | Anti PGLYRP1 pAb (ATL-HPA070227) at Atlas Antibodies |
Documents & Links for Anti PGLYRP1 pAb (ATL-HPA070227) | |
Datasheet | Anti PGLYRP1 pAb (ATL-HPA070227) Datasheet (External Link) |
Vendor Page | Anti PGLYRP1 pAb (ATL-HPA070227) |