Protein Description: piggyBac transposable element derived 5
Gene Name: PGBD5
Alternative Gene Name: DKFZp761A0620, FLJ11413
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050751: 92%, ENSRNOG00000026791: 93%
Entrez Gene ID: 79605
Uniprot ID: Q8N414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PGBD5
Alternative Gene Name: DKFZp761A0620, FLJ11413
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050751: 92%, ENSRNOG00000026791: 93%
Entrez Gene ID: 79605
Uniprot ID: Q8N414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISH |
| Documents & Links for Anti PGBD5 pAb (ATL-HPA065010) | |
| Datasheet | Anti PGBD5 pAb (ATL-HPA065010) Datasheet (External Link) |
| Vendor Page | Anti PGBD5 pAb (ATL-HPA065010) at Atlas |
| Documents & Links for Anti PGBD5 pAb (ATL-HPA065010) | |
| Datasheet | Anti PGBD5 pAb (ATL-HPA065010) Datasheet (External Link) |
| Vendor Page | Anti PGBD5 pAb (ATL-HPA065010) |