Anti PGBD5 pAb (ATL-HPA065010)

Catalog No:
ATL-HPA065010-25
$303.00

Description

Product Description

Protein Description: piggyBac transposable element derived 5
Gene Name: PGBD5
Alternative Gene Name: DKFZp761A0620, FLJ11413
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050751: 92%, ENSRNOG00000026791: 93%
Entrez Gene ID: 79605
Uniprot ID: Q8N414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISH
Gene Sequence LPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISH
Gene ID - Mouse ENSMUSG00000050751
Gene ID - Rat ENSRNOG00000026791
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PGBD5 pAb (ATL-HPA065010)
Datasheet Anti PGBD5 pAb (ATL-HPA065010) Datasheet (External Link)
Vendor Page Anti PGBD5 pAb (ATL-HPA065010) at Atlas Antibodies

Documents & Links for Anti PGBD5 pAb (ATL-HPA065010)
Datasheet Anti PGBD5 pAb (ATL-HPA065010) Datasheet (External Link)
Vendor Page Anti PGBD5 pAb (ATL-HPA065010)

Product Description

Protein Description: piggyBac transposable element derived 5
Gene Name: PGBD5
Alternative Gene Name: DKFZp761A0620, FLJ11413
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050751: 92%, ENSRNOG00000026791: 93%
Entrez Gene ID: 79605
Uniprot ID: Q8N414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISH
Gene Sequence LPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISH
Gene ID - Mouse ENSMUSG00000050751
Gene ID - Rat ENSRNOG00000026791
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PGBD5 pAb (ATL-HPA065010)
Datasheet Anti PGBD5 pAb (ATL-HPA065010) Datasheet (External Link)
Vendor Page Anti PGBD5 pAb (ATL-HPA065010) at Atlas Antibodies

Documents & Links for Anti PGBD5 pAb (ATL-HPA065010)
Datasheet Anti PGBD5 pAb (ATL-HPA065010) Datasheet (External Link)
Vendor Page Anti PGBD5 pAb (ATL-HPA065010)