Anti PGAP1 pAb (ATL-HPA069704)

Catalog No:
ATL-HPA069704-25
$401.00
Protein Description: post-GPI attachment to proteins 1
Gene Name: PGAP1
Alternative Gene Name: Bst1, FLJ12377, SPG67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073678: 89%, ENSRNOG00000013388: 91%
Entrez Gene ID: 80055
Uniprot ID: Q75T13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST

Documents & Links for Anti PGAP1 pAb (ATL-HPA069704)
Datasheet Anti PGAP1 pAb (ATL-HPA069704) Datasheet (External Link)
Vendor Page Anti PGAP1 pAb (ATL-HPA069704) at Atlas

Documents & Links for Anti PGAP1 pAb (ATL-HPA069704)
Datasheet Anti PGAP1 pAb (ATL-HPA069704) Datasheet (External Link)
Vendor Page Anti PGAP1 pAb (ATL-HPA069704)