Description
Product Description
Protein Description: post-GPI attachment to proteins 1
Gene Name: PGAP1
Alternative Gene Name: Bst1, FLJ12377, SPG67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073678: 89%, ENSRNOG00000013388: 91%
Entrez Gene ID: 80055
Uniprot ID: Q75T13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PGAP1
Alternative Gene Name: Bst1, FLJ12377, SPG67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073678: 89%, ENSRNOG00000013388: 91%
Entrez Gene ID: 80055
Uniprot ID: Q75T13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST |
Gene Sequence | HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST |
Gene ID - Mouse | ENSMUSG00000073678 |
Gene ID - Rat | ENSRNOG00000013388 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PGAP1 pAb (ATL-HPA069704) | |
Datasheet | Anti PGAP1 pAb (ATL-HPA069704) Datasheet (External Link) |
Vendor Page | Anti PGAP1 pAb (ATL-HPA069704) at Atlas Antibodies |
Documents & Links for Anti PGAP1 pAb (ATL-HPA069704) | |
Datasheet | Anti PGAP1 pAb (ATL-HPA069704) Datasheet (External Link) |
Vendor Page | Anti PGAP1 pAb (ATL-HPA069704) |