Description
Product Description
Protein Description: peroxisomal biogenesis factor 3
Gene Name: PEX3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019809: 84%, ENSRNOG00000015660: 86%
Entrez Gene ID: 8504
Uniprot ID: P56589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PEX3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019809: 84%, ENSRNOG00000015660: 86%
Entrez Gene ID: 8504
Uniprot ID: P56589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN |
Gene Sequence | SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN |
Gene ID - Mouse | ENSMUSG00000019809 |
Gene ID - Rat | ENSRNOG00000015660 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation) | |
Datasheet | Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation) | |
Datasheet | Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation) |