Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA058006-25

• 
• 

Product Description

Protein Description: peroxisomal biogenesis factor 3
Gene Name: PEX3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019809: 84%, ENSRNOG00000015660: 86%
Entrez Gene ID: 8504
Uniprot ID: P56589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN
• Gene Sequence: SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN
• Gene ID - Mouse: ENSMUSG00000019809
• Gene ID - Rat: ENSRNOG00000015660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.