Protein Description: PET100 homolog
Gene Name: PET100
Alternative Gene Name: C19orf79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087687: 60%, ENSRNOG00000050169: 63%
Entrez Gene ID: 100131801
Uniprot ID: P0DJ07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PET100
Alternative Gene Name: C19orf79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087687: 60%, ENSRNOG00000050169: 63%
Entrez Gene ID: 100131801
Uniprot ID: P0DJ07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ELWPPEKLQEIEEFKERLRKRREEKLLRDAQQ |
Documents & Links for Anti PET100 pAb (ATL-HPA067288) | |
Datasheet | Anti PET100 pAb (ATL-HPA067288) Datasheet (External Link) |
Vendor Page | Anti PET100 pAb (ATL-HPA067288) at Atlas |
Documents & Links for Anti PET100 pAb (ATL-HPA067288) | |
Datasheet | Anti PET100 pAb (ATL-HPA067288) Datasheet (External Link) |
Vendor Page | Anti PET100 pAb (ATL-HPA067288) |