Anti PET100 pAb (ATL-HPA067288)

Catalog No:
ATL-HPA067288-25
$447.00

Description

Product Description

Protein Description: PET100 homolog
Gene Name: PET100
Alternative Gene Name: C19orf79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087687: 60%, ENSRNOG00000050169: 63%
Entrez Gene ID: 100131801
Uniprot ID: P0DJ07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELWPPEKLQEIEEFKERLRKRREEKLLRDAQQ
Gene Sequence ELWPPEKLQEIEEFKERLRKRREEKLLRDAQQ
Gene ID - Mouse ENSMUSG00000087687
Gene ID - Rat ENSRNOG00000050169
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PET100 pAb (ATL-HPA067288)
Datasheet Anti PET100 pAb (ATL-HPA067288) Datasheet (External Link)
Vendor Page Anti PET100 pAb (ATL-HPA067288) at Atlas Antibodies

Documents & Links for Anti PET100 pAb (ATL-HPA067288)
Datasheet Anti PET100 pAb (ATL-HPA067288) Datasheet (External Link)
Vendor Page Anti PET100 pAb (ATL-HPA067288)

Product Description

Protein Description: PET100 homolog
Gene Name: PET100
Alternative Gene Name: C19orf79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087687: 60%, ENSRNOG00000050169: 63%
Entrez Gene ID: 100131801
Uniprot ID: P0DJ07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELWPPEKLQEIEEFKERLRKRREEKLLRDAQQ
Gene Sequence ELWPPEKLQEIEEFKERLRKRREEKLLRDAQQ
Gene ID - Mouse ENSMUSG00000087687
Gene ID - Rat ENSRNOG00000050169
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PET100 pAb (ATL-HPA067288)
Datasheet Anti PET100 pAb (ATL-HPA067288) Datasheet (External Link)
Vendor Page Anti PET100 pAb (ATL-HPA067288) at Atlas Antibodies

Documents & Links for Anti PET100 pAb (ATL-HPA067288)
Datasheet Anti PET100 pAb (ATL-HPA067288) Datasheet (External Link)
Vendor Page Anti PET100 pAb (ATL-HPA067288)