Protein Description: pescadillo ribosomal biogenesis factor 1
Gene Name: PES1
Alternative Gene Name: PES
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020430: 85%, ENSRNOG00000004515: 84%
Entrez Gene ID: 23481
Uniprot ID: O00541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PES1
Alternative Gene Name: PES
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020430: 85%, ENSRNOG00000004515: 84%
Entrez Gene ID: 23481
Uniprot ID: O00541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKE |
| Documents & Links for Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) | |
| Datasheet | Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) at Atlas |
| Documents & Links for Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) | |
| Datasheet | Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) |
| Citations for Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) – 1 Found |
| Ognibene, Marzia; Pezzolo, Annalisa. Roniciclib down-regulates stemness and inhibits cell growth by inducing nucleolar stress in neuroblastoma. Scientific Reports. 2020;10(1):12902. PubMed |