Protein Description: peptidase D
Gene Name: PEPD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063931: 91%, ENSRNOG00000037188: 25%
Entrez Gene ID: 5184
Uniprot ID: P12955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PEPD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063931: 91%, ENSRNOG00000037188: 25%
Entrez Gene ID: 5184
Uniprot ID: P12955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISK |
| Documents & Links for Anti PEPD pAb (ATL-HPA072045) | |
| Datasheet | Anti PEPD pAb (ATL-HPA072045) Datasheet (External Link) |
| Vendor Page | Anti PEPD pAb (ATL-HPA072045) at Atlas |
| Documents & Links for Anti PEPD pAb (ATL-HPA072045) | |
| Datasheet | Anti PEPD pAb (ATL-HPA072045) Datasheet (External Link) |
| Vendor Page | Anti PEPD pAb (ATL-HPA072045) |