Anti PELP1 pAb (ATL-HPA060760)

Atlas Antibodies

Catalog No: ATL-HPA060760-25

• 

Product Description

Protein Description: proline, glutamate and leucine rich protein 1
Gene Name: PELP1
Alternative Gene Name: MNAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018921: 96%, ENSRNOG00000019268: 94%
Entrez Gene ID: 27043
Uniprot ID: Q8IZL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE
• Gene Sequence: GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE
• Gene ID - Mouse: ENSMUSG00000018921
• Gene ID - Rat: ENSRNOG00000019268
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.