Anti PELP1 pAb (ATL-HPA060760)

Catalog No:
ATL-HPA060760-25
$303.00

Description

Product Description

Protein Description: proline, glutamate and leucine rich protein 1
Gene Name: PELP1
Alternative Gene Name: MNAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018921: 96%, ENSRNOG00000019268: 94%
Entrez Gene ID: 27043
Uniprot ID: Q8IZL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE
Gene Sequence GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE
Gene ID - Mouse ENSMUSG00000018921
Gene ID - Rat ENSRNOG00000019268
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PELP1 pAb (ATL-HPA060760)
Datasheet Anti PELP1 pAb (ATL-HPA060760) Datasheet (External Link)
Vendor Page Anti PELP1 pAb (ATL-HPA060760) at Atlas Antibodies

Documents & Links for Anti PELP1 pAb (ATL-HPA060760)
Datasheet Anti PELP1 pAb (ATL-HPA060760) Datasheet (External Link)
Vendor Page Anti PELP1 pAb (ATL-HPA060760)

Product Description

Protein Description: proline, glutamate and leucine rich protein 1
Gene Name: PELP1
Alternative Gene Name: MNAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018921: 96%, ENSRNOG00000019268: 94%
Entrez Gene ID: 27043
Uniprot ID: Q8IZL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE
Gene Sequence GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE
Gene ID - Mouse ENSMUSG00000018921
Gene ID - Rat ENSRNOG00000019268
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PELP1 pAb (ATL-HPA060760)
Datasheet Anti PELP1 pAb (ATL-HPA060760) Datasheet (External Link)
Vendor Page Anti PELP1 pAb (ATL-HPA060760) at Atlas Antibodies

Documents & Links for Anti PELP1 pAb (ATL-HPA060760)
Datasheet Anti PELP1 pAb (ATL-HPA060760) Datasheet (External Link)
Vendor Page Anti PELP1 pAb (ATL-HPA060760)