![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to nucleoplasm, nucleoli & mitotic chromosome.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/104553/184476/atl-hpa073228_anti-pelo-atl-hpa073228_67936__18045.1710522879.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to nucleoplasm, nucleoli & mitotic chromosome.")
![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to nucleoplasm, nucleoli & mitotic chromosome.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/104553/184476/atl-hpa073228_anti-pelo-atl-hpa073228_67936__18045.1710522879.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to nucleoplasm, nucleoli & mitotic chromosome.")
Polyclonal Antibody against Human PELO, Gene description: pelota mRNA surveillance and ribosome rescue factor, Validated applications: ICC, Uniprot ID: Q9BRX2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED |
| Gene ID - Mouse | ENSMUSG00000042275 |
| Gene ID - Rat | ENSMUSG00000042275 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-PELO pAb (ATL-HPA073228) | |
| Vendor Page | Anti-PELO pAb (ATL-HPA073228) at Atlas |
| Documents & Links for Anti-PELO pAb (ATL-HPA073228) | |
| Vendor Page | Anti-PELO pAb (ATL-HPA073228) |