Polyclonal Antibody against Human PELO, Gene description: pelota mRNA surveillance and ribosome rescue factor, Validated applications: ICC, Uniprot ID: Q9BRX2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED |
Gene ID - Mouse | ENSMUSG00000042275 |
Gene ID - Rat | ENSMUSG00000042275 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-PELO pAb (ATL-HPA073228) | |
Vendor Page | Anti-PELO pAb (ATL-HPA073228) at Atlas |
Documents & Links for Anti-PELO pAb (ATL-HPA073228) | |
Vendor Page | Anti-PELO pAb (ATL-HPA073228) |