Anti PDZD3 pAb (ATL-HPA077887)

Atlas Antibodies

Catalog No: ATL-HPA077887-25

• 

Product Description

Protein Description: PDZ domain containing 3
Gene Name: PDZD3
Alternative Gene Name: FLJ22756, IKEPP, PDZK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032105: 55%, ENSRNOG00000008526: 55%
Entrez Gene ID: 79849
Uniprot ID: Q86UT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDV
• Gene Sequence: PSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDV
• Gene ID - Mouse: ENSMUSG00000032105
• Gene ID - Rat: ENSRNOG00000008526
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.