Protein Description: PDZ domain containing 3
Gene Name: PDZD3
Alternative Gene Name: FLJ22756, IKEPP, PDZK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032105: 55%, ENSRNOG00000008526: 55%
Entrez Gene ID: 79849
Uniprot ID: Q86UT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDZD3
Alternative Gene Name: FLJ22756, IKEPP, PDZK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032105: 55%, ENSRNOG00000008526: 55%
Entrez Gene ID: 79849
Uniprot ID: Q86UT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDV |
| Documents & Links for Anti PDZD3 pAb (ATL-HPA077887) | |
| Datasheet | Anti PDZD3 pAb (ATL-HPA077887) Datasheet (External Link) |
| Vendor Page | Anti PDZD3 pAb (ATL-HPA077887) at Atlas |
| Documents & Links for Anti PDZD3 pAb (ATL-HPA077887) | |
| Datasheet | Anti PDZD3 pAb (ATL-HPA077887) Datasheet (External Link) |
| Vendor Page | Anti PDZD3 pAb (ATL-HPA077887) |