Description
Product Description
Protein Description: pyridoxal (pyridoxine, vitamin B6) kinase
Gene Name: PDXK
Alternative Gene Name: C21orf124, C21orf97, FLJ21324, FLJ31940, MGC15873, PKH, PNK, PRED79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032788: 88%, ENSRNOG00000049937: 86%
Entrez Gene ID: 8566
Uniprot ID: O00764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDXK
Alternative Gene Name: C21orf124, C21orf97, FLJ21324, FLJ31940, MGC15873, PKH, PNK, PRED79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032788: 88%, ENSRNOG00000049937: 86%
Entrez Gene ID: 8566
Uniprot ID: O00764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQ |
| Gene Sequence | LLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQ |
| Gene ID - Mouse | ENSMUSG00000032788 |
| Gene ID - Rat | ENSRNOG00000049937 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) | |
| Datasheet | Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) | |
| Datasheet | Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) |
Citations
| Citations for Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) – 1 Found |
| Chen, Chi-Chao; Li, Bo; Millman, Scott E; Chen, Cynthia; Li, Xiang; Morris, John P 4th; Mayle, Allison; Ho, Yu-Jui; Loizou, Evangelia; Liu, Hui; Qin, Weige; Shah, Hardik; Violante, Sara; Cross, Justin R; Lowe, Scott W; Zhang, Lingbo. Vitamin B6 Addiction in Acute Myeloid Leukemia. Cancer Cell. 2020;37(1):71-84.e7. PubMed |