Anti PDRG1 pAb (ATL-HPA063542)

Atlas Antibodies

Catalog No: ATL-HPA063542-25

• 

Product Description

Protein Description: p53 and DNA-damage regulated 1
Gene Name: PDRG1
Alternative Gene Name: C20orf126, dJ310O13.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027472: 94%, ENSRNOG00000008845: 87%
Entrez Gene ID: 81572
Uniprot ID: Q9NUG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLSPEAERVLRYLVEVEELAEEVLADKRQIV
• Gene Sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIV
• Gene ID - Mouse: ENSMUSG00000027472
• Gene ID - Rat: ENSRNOG00000008845
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.