Protein Description: p53 and DNA-damage regulated 1
Gene Name: PDRG1
Alternative Gene Name: C20orf126, dJ310O13.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027472: 94%, ENSRNOG00000008845: 87%
Entrez Gene ID: 81572
Uniprot ID: Q9NUG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDRG1
Alternative Gene Name: C20orf126, dJ310O13.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027472: 94%, ENSRNOG00000008845: 87%
Entrez Gene ID: 81572
Uniprot ID: Q9NUG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MLSPEAERVLRYLVEVEELAEEVLADKRQIV |
| Documents & Links for Anti PDRG1 pAb (ATL-HPA063542) | |
| Datasheet | Anti PDRG1 pAb (ATL-HPA063542) Datasheet (External Link) |
| Vendor Page | Anti PDRG1 pAb (ATL-HPA063542) at Atlas |
| Documents & Links for Anti PDRG1 pAb (ATL-HPA063542) | |
| Datasheet | Anti PDRG1 pAb (ATL-HPA063542) Datasheet (External Link) |
| Vendor Page | Anti PDRG1 pAb (ATL-HPA063542) |