Description
Product Description
Protein Description: pyruvate dehydrogenase kinase, isozyme 4
Gene Name: PDK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019577: 93%, ENSRNOG00000009565: 95%
Entrez Gene ID: 5166
Uniprot ID: Q16654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019577: 93%, ENSRNOG00000009565: 95%
Entrez Gene ID: 5166
Uniprot ID: Q16654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQG |
| Gene Sequence | QSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQG |
| Gene ID - Mouse | ENSMUSG00000019577 |
| Gene ID - Rat | ENSRNOG00000009565 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti PDK4 pAb (ATL-HPA056731) | |
| Datasheet | Anti PDK4 pAb (ATL-HPA056731) Datasheet (External Link) |
| Vendor Page | Anti PDK4 pAb (ATL-HPA056731) at Atlas Antibodies |
| Documents & Links for Anti PDK4 pAb (ATL-HPA056731) | |
| Datasheet | Anti PDK4 pAb (ATL-HPA056731) Datasheet (External Link) |
| Vendor Page | Anti PDK4 pAb (ATL-HPA056731) |
Citations
| Citations for Anti PDK4 pAb (ATL-HPA056731) – 1 Found |
| Nunes-Xavier, Caroline E; Mingo, Janire; Emaldi, Maite; Flem-Karlsen, Karine; Mælandsmo, Gunhild M; Fodstad, Øystein; Llarena, Roberto; López, José I; Pulido, Rafael. Heterogeneous Expression and Subcellular Localization of Pyruvate Dehydrogenase Complex in Prostate Cancer. Frontiers In Oncology. 12( 35692804):873516. PubMed |