Anti PDK3 pAb (ATL-HPA072492)

Catalog No:
ATL-HPA072492-25
$303.00

Description

Product Description

Protein Description: pyruvate dehydrogenase kinase, isozyme 3
Gene Name: PDK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035232: 98%, ENSRNOG00000012513: 95%
Entrez Gene ID: 5165
Uniprot ID: Q15120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKTNRTF
Gene Sequence SAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKTNRTF
Gene ID - Mouse ENSMUSG00000035232
Gene ID - Rat ENSRNOG00000012513
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PDK3 pAb (ATL-HPA072492)
Datasheet Anti PDK3 pAb (ATL-HPA072492) Datasheet (External Link)
Vendor Page Anti PDK3 pAb (ATL-HPA072492) at Atlas Antibodies

Documents & Links for Anti PDK3 pAb (ATL-HPA072492)
Datasheet Anti PDK3 pAb (ATL-HPA072492) Datasheet (External Link)
Vendor Page Anti PDK3 pAb (ATL-HPA072492)

Product Description

Protein Description: pyruvate dehydrogenase kinase, isozyme 3
Gene Name: PDK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035232: 98%, ENSRNOG00000012513: 95%
Entrez Gene ID: 5165
Uniprot ID: Q15120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKTNRTF
Gene Sequence SAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKTNRTF
Gene ID - Mouse ENSMUSG00000035232
Gene ID - Rat ENSRNOG00000012513
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PDK3 pAb (ATL-HPA072492)
Datasheet Anti PDK3 pAb (ATL-HPA072492) Datasheet (External Link)
Vendor Page Anti PDK3 pAb (ATL-HPA072492) at Atlas Antibodies

Documents & Links for Anti PDK3 pAb (ATL-HPA072492)
Datasheet Anti PDK3 pAb (ATL-HPA072492) Datasheet (External Link)
Vendor Page Anti PDK3 pAb (ATL-HPA072492)