Protein Description: pyruvate dehydrogenase kinase, isozyme 3
Gene Name: PDK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035232: 98%, ENSRNOG00000012513: 95%
Entrez Gene ID: 5165
Uniprot ID: Q15120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035232: 98%, ENSRNOG00000012513: 95%
Entrez Gene ID: 5165
Uniprot ID: Q15120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKTNRTF |
Documents & Links for Anti PDK3 pAb (ATL-HPA072492) | |
Datasheet | Anti PDK3 pAb (ATL-HPA072492) Datasheet (External Link) |
Vendor Page | Anti PDK3 pAb (ATL-HPA072492) at Atlas |
Documents & Links for Anti PDK3 pAb (ATL-HPA072492) | |
Datasheet | Anti PDK3 pAb (ATL-HPA072492) Datasheet (External Link) |
Vendor Page | Anti PDK3 pAb (ATL-HPA072492) |