Protein Description: platelet-derived growth factor receptor, alpha polypeptide
Gene Name: PDGFRA
Alternative Gene Name: CD140a, PDGFR2
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 5156
Uniprot ID: P16234
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDGFRA
Alternative Gene Name: CD140a, PDGFR2
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 5156
Uniprot ID: P16234
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG |
Documents & Links for Anti PDGFRA pAb (ATL-HPA004947) | |
Datasheet | Anti PDGFRA pAb (ATL-HPA004947) Datasheet (External Link) |
Vendor Page | Anti PDGFRA pAb (ATL-HPA004947) at Atlas |
Documents & Links for Anti PDGFRA pAb (ATL-HPA004947) | |
Datasheet | Anti PDGFRA pAb (ATL-HPA004947) Datasheet (External Link) |
Vendor Page | Anti PDGFRA pAb (ATL-HPA004947) |