Description
Product Description
Protein Description: platelet derived growth factor D
Gene Name: PDGFD
Alternative Gene Name: IEGF, MSTP036, SCDGF-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032006: 86%, ENSRNOG00000029148: 86%
Entrez Gene ID: 80310
Uniprot ID: Q9GZP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDGFD
Alternative Gene Name: IEGF, MSTP036, SCDGF-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032006: 86%, ENSRNOG00000029148: 86%
Entrez Gene ID: 80310
Uniprot ID: Q9GZP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP |
Gene Sequence | YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP |
Gene ID - Mouse | ENSMUSG00000032006 |
Gene ID - Rat | ENSRNOG00000029148 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PDGFD pAb (ATL-HPA066271) | |
Datasheet | Anti PDGFD pAb (ATL-HPA066271) Datasheet (External Link) |
Vendor Page | Anti PDGFD pAb (ATL-HPA066271) at Atlas Antibodies |
Documents & Links for Anti PDGFD pAb (ATL-HPA066271) | |
Datasheet | Anti PDGFD pAb (ATL-HPA066271) Datasheet (External Link) |
Vendor Page | Anti PDGFD pAb (ATL-HPA066271) |