Protein Description: platelet derived growth factor D
Gene Name: PDGFD
Alternative Gene Name: IEGF, MSTP036, SCDGF-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032006: 86%, ENSRNOG00000029148: 86%
Entrez Gene ID: 80310
Uniprot ID: Q9GZP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDGFD
Alternative Gene Name: IEGF, MSTP036, SCDGF-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032006: 86%, ENSRNOG00000029148: 86%
Entrez Gene ID: 80310
Uniprot ID: Q9GZP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP |
| Documents & Links for Anti PDGFD pAb (ATL-HPA066271) | |
| Datasheet | Anti PDGFD pAb (ATL-HPA066271) Datasheet (External Link) |
| Vendor Page | Anti PDGFD pAb (ATL-HPA066271) at Atlas |
| Documents & Links for Anti PDGFD pAb (ATL-HPA066271) | |
| Datasheet | Anti PDGFD pAb (ATL-HPA066271) Datasheet (External Link) |
| Vendor Page | Anti PDGFD pAb (ATL-HPA066271) |