Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation)

Atlas

Catalog No: ATL-HPA036912-25

• 

Protein Description: phosphodiesterase 8B
Gene Name: PDE8B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021684: 94%, ENSRNOG00000010280: 93%
Entrez Gene ID: 8622
Uniprot ID: O95263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS
• Gene Sequence: FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS
• Gene ID - Mouse: ENSMUSG00000021684
• Gene ID - Rat: ENSRNOG00000010280
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDE8B pAb (ATL-HPA036912 w/enhanced validation) – 1 Found

Campolo, Federica; Capponi, Chiara; Tarsitano, Maria Grazia; Tenuta, Marta; Pozza, Carlotta; Gianfrilli, Daniele; Magliocca, Fabio; Venneri, Mary A; Vicini, Elena; Lenzi, Andrea; Isidori, Andrea M; Barbagallo, Federica. cAMP-specific phosphodiesterase 8A and 8B isoforms are differentially expressed in human testis and Leydig cell tumor. Frontiers In Endocrinology. 13( 36277728):1010924.