Protein Description: phosphodiesterase 6A, cGMP-specific, rod, alpha
Gene Name: PDE6A
Alternative Gene Name: PDEA, RP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024575: 97%, ENSRNOG00000017816: 97%
Entrez Gene ID: 5145
Uniprot ID: P16499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDE6A
Alternative Gene Name: PDEA, RP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024575: 97%, ENSRNOG00000017816: 97%
Entrez Gene ID: 5145
Uniprot ID: P16499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN |
Gene Sequence | TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN |
Gene ID - Mouse | ENSMUSG00000024575 |
Gene ID - Rat | ENSRNOG00000017816 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDE6A pAb (ATL-HPA016970 w/enhanced validation) | |
Datasheet | Anti PDE6A pAb (ATL-HPA016970 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PDE6A pAb (ATL-HPA016970 w/enhanced validation) at Atlas |
Documents & Links for Anti PDE6A pAb (ATL-HPA016970 w/enhanced validation) | |
Datasheet | Anti PDE6A pAb (ATL-HPA016970 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PDE6A pAb (ATL-HPA016970 w/enhanced validation) |
Citations for Anti PDE6A pAb (ATL-HPA016970 w/enhanced validation) – 1 Found |
Kiflemariam, Sara; Andersson, Sandra; Asplund, Anna; Pontén, Fredrik; Sjöblom, Tobias. Scalable in situ hybridization on tissue arrays for validation of novel cancer and tissue-specific biomarkers. Plos One. 7(3):e32927. PubMed |