Protein Description: phosphodiesterase 2A, cGMP-stimulated
Gene Name: PDE2A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110195: 99%, ENSRNOG00000019560: 97%
Entrez Gene ID: 5138
Uniprot ID: O00408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDE2A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110195: 99%, ENSRNOG00000019560: 97%
Entrez Gene ID: 5138
Uniprot ID: O00408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPA |
Gene Sequence | EHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPA |
Gene ID - Mouse | ENSMUSG00000110195 |
Gene ID - Rat | ENSRNOG00000019560 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDE2A pAb (ATL-HPA031192 w/enhanced validation) | |
Datasheet | Anti PDE2A pAb (ATL-HPA031192 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PDE2A pAb (ATL-HPA031192 w/enhanced validation) at Atlas |
Documents & Links for Anti PDE2A pAb (ATL-HPA031192 w/enhanced validation) | |
Datasheet | Anti PDE2A pAb (ATL-HPA031192 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PDE2A pAb (ATL-HPA031192 w/enhanced validation) |