Protein Description: programmed cell death 4 (neoplastic transformation inhibitor)
Gene Name: PDCD4
Alternative Gene Name: H731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024975: 98%, ENSRNOG00000014779: 98%
Entrez Gene ID: 27250
Uniprot ID: Q53EL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDCD4
Alternative Gene Name: H731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024975: 98%, ENSRNOG00000014779: 98%
Entrez Gene ID: 27250
Uniprot ID: Q53EL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSL |
Gene Sequence | RSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSL |
Gene ID - Mouse | ENSMUSG00000024975 |
Gene ID - Rat | ENSRNOG00000014779 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDCD4 pAb (ATL-HPA027214) | |
Datasheet | Anti PDCD4 pAb (ATL-HPA027214) Datasheet (External Link) |
Vendor Page | Anti PDCD4 pAb (ATL-HPA027214) at Atlas |
Documents & Links for Anti PDCD4 pAb (ATL-HPA027214) | |
Datasheet | Anti PDCD4 pAb (ATL-HPA027214) Datasheet (External Link) |
Vendor Page | Anti PDCD4 pAb (ATL-HPA027214) |