Protein Description: Purkinje cell protein 2
Gene Name: PCP2
Alternative Gene Name: GPSM4, MGC41903
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004630: 82%, ENSRNOG00000000993: 85%
Entrez Gene ID: 126006
Uniprot ID: Q8IVA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCP2
Alternative Gene Name: GPSM4, MGC41903
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004630: 82%, ENSRNOG00000000993: 85%
Entrez Gene ID: 126006
Uniprot ID: Q8IVA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPL |
Gene Sequence | DQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPL |
Gene ID - Mouse | ENSMUSG00000004630 |
Gene ID - Rat | ENSRNOG00000000993 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PCP2 pAb (ATL-HPA057428) | |
Datasheet | Anti PCP2 pAb (ATL-HPA057428) Datasheet (External Link) |
Vendor Page | Anti PCP2 pAb (ATL-HPA057428) at Atlas Antibodies |
Documents & Links for Anti PCP2 pAb (ATL-HPA057428) | |
Datasheet | Anti PCP2 pAb (ATL-HPA057428) Datasheet (External Link) |
Vendor Page | Anti PCP2 pAb (ATL-HPA057428) |