Anti PCMTD1 pAb (ATL-HPA061444)

Atlas Antibodies

Catalog No: ATL-HPA061444-25

• 

Product Description

Protein Description: protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1
Gene Name: PCMTD1
Alternative Gene Name: FLJ10883
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051285: 100%, ENSRNOG00000005730: 100%
Entrez Gene ID: 115294
Uniprot ID: Q96MG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVF
• Gene Sequence: DLARIYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVF
• Gene ID - Mouse: ENSMUSG00000051285
• Gene ID - Rat: ENSRNOG00000005730
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.