Anti PCID2 pAb (ATL-HPA073074)

Catalog No:
ATL-HPA073074-25
$447.00

Description

Product Description

Protein Description: PCI domain containing 2
Gene Name: PCID2
Alternative Gene Name: FLJ11305
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038542: 99%, ENSRNOG00000025222: 100%
Entrez Gene ID: 55795
Uniprot ID: Q5JVF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS
Gene Sequence VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS
Gene ID - Mouse ENSMUSG00000038542
Gene ID - Rat ENSRNOG00000025222
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PCID2 pAb (ATL-HPA073074)
Datasheet Anti PCID2 pAb (ATL-HPA073074) Datasheet (External Link)
Vendor Page Anti PCID2 pAb (ATL-HPA073074) at Atlas Antibodies

Documents & Links for Anti PCID2 pAb (ATL-HPA073074)
Datasheet Anti PCID2 pAb (ATL-HPA073074) Datasheet (External Link)
Vendor Page Anti PCID2 pAb (ATL-HPA073074)

Product Description

Protein Description: PCI domain containing 2
Gene Name: PCID2
Alternative Gene Name: FLJ11305
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038542: 99%, ENSRNOG00000025222: 100%
Entrez Gene ID: 55795
Uniprot ID: Q5JVF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS
Gene Sequence VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS
Gene ID - Mouse ENSMUSG00000038542
Gene ID - Rat ENSRNOG00000025222
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PCID2 pAb (ATL-HPA073074)
Datasheet Anti PCID2 pAb (ATL-HPA073074) Datasheet (External Link)
Vendor Page Anti PCID2 pAb (ATL-HPA073074) at Atlas Antibodies

Documents & Links for Anti PCID2 pAb (ATL-HPA073074)
Datasheet Anti PCID2 pAb (ATL-HPA073074) Datasheet (External Link)
Vendor Page Anti PCID2 pAb (ATL-HPA073074)