Description
Product Description
Protein Description: PCI domain containing 2
Gene Name: PCID2
Alternative Gene Name: FLJ11305
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038542: 99%, ENSRNOG00000025222: 100%
Entrez Gene ID: 55795
Uniprot ID: Q5JVF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCID2
Alternative Gene Name: FLJ11305
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038542: 99%, ENSRNOG00000025222: 100%
Entrez Gene ID: 55795
Uniprot ID: Q5JVF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS |
Gene Sequence | VCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDS |
Gene ID - Mouse | ENSMUSG00000038542 |
Gene ID - Rat | ENSRNOG00000025222 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PCID2 pAb (ATL-HPA073074) | |
Datasheet | Anti PCID2 pAb (ATL-HPA073074) Datasheet (External Link) |
Vendor Page | Anti PCID2 pAb (ATL-HPA073074) at Atlas Antibodies |
Documents & Links for Anti PCID2 pAb (ATL-HPA073074) | |
Datasheet | Anti PCID2 pAb (ATL-HPA073074) Datasheet (External Link) |
Vendor Page | Anti PCID2 pAb (ATL-HPA073074) |