Anti PCGF5 pAb (ATL-HPA059071)

Atlas Antibodies

Catalog No: ATL-HPA059071-25

• 

Product Description

Protein Description: polycomb group ring finger 5
Gene Name: PCGF5
Alternative Gene Name: MGC16202, RNF159
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024805: 95%, ENSRNOG00000018532: 68%
Entrez Gene ID: 84333
Uniprot ID: Q86SE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRID
• Gene Sequence: DVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRID
• Gene ID - Mouse: ENSMUSG00000024805
• Gene ID - Rat: ENSRNOG00000018532
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.