Description
Product Description
Protein Description: polycomb group ring finger 3
Gene Name: PCGF3
Alternative Gene Name: DONG1, FLJ36550, MGC40413, RNF3, RNF3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033623: 98%, ENSRNOG00000000062: 98%
Entrez Gene ID: 10336
Uniprot ID: Q3KNV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCGF3
Alternative Gene Name: DONG1, FLJ36550, MGC40413, RNF3, RNF3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033623: 98%, ENSRNOG00000000062: 98%
Entrez Gene ID: 10336
Uniprot ID: Q3KNV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI |
Gene Sequence | EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI |
Gene ID - Mouse | ENSMUSG00000033623 |
Gene ID - Rat | ENSRNOG00000000062 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PCGF3 pAb (ATL-HPA061879) | |
Datasheet | Anti PCGF3 pAb (ATL-HPA061879) Datasheet (External Link) |
Vendor Page | Anti PCGF3 pAb (ATL-HPA061879) at Atlas Antibodies |
Documents & Links for Anti PCGF3 pAb (ATL-HPA061879) | |
Datasheet | Anti PCGF3 pAb (ATL-HPA061879) Datasheet (External Link) |
Vendor Page | Anti PCGF3 pAb (ATL-HPA061879) |