Anti PCGF3 pAb (ATL-HPA061879)

Catalog No:
ATL-HPA061879-25
$447.00

Description

Product Description

Protein Description: polycomb group ring finger 3
Gene Name: PCGF3
Alternative Gene Name: DONG1, FLJ36550, MGC40413, RNF3, RNF3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033623: 98%, ENSRNOG00000000062: 98%
Entrez Gene ID: 10336
Uniprot ID: Q3KNV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI
Gene Sequence EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI
Gene ID - Mouse ENSMUSG00000033623
Gene ID - Rat ENSRNOG00000000062
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PCGF3 pAb (ATL-HPA061879)
Datasheet Anti PCGF3 pAb (ATL-HPA061879) Datasheet (External Link)
Vendor Page Anti PCGF3 pAb (ATL-HPA061879) at Atlas Antibodies

Documents & Links for Anti PCGF3 pAb (ATL-HPA061879)
Datasheet Anti PCGF3 pAb (ATL-HPA061879) Datasheet (External Link)
Vendor Page Anti PCGF3 pAb (ATL-HPA061879)

Product Description

Protein Description: polycomb group ring finger 3
Gene Name: PCGF3
Alternative Gene Name: DONG1, FLJ36550, MGC40413, RNF3, RNF3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033623: 98%, ENSRNOG00000000062: 98%
Entrez Gene ID: 10336
Uniprot ID: Q3KNV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI
Gene Sequence EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI
Gene ID - Mouse ENSMUSG00000033623
Gene ID - Rat ENSRNOG00000000062
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PCGF3 pAb (ATL-HPA061879)
Datasheet Anti PCGF3 pAb (ATL-HPA061879) Datasheet (External Link)
Vendor Page Anti PCGF3 pAb (ATL-HPA061879) at Atlas Antibodies

Documents & Links for Anti PCGF3 pAb (ATL-HPA061879)
Datasheet Anti PCGF3 pAb (ATL-HPA061879) Datasheet (External Link)
Vendor Page Anti PCGF3 pAb (ATL-HPA061879)