Description
Product Description
Protein Description: protocadherin gamma subfamily C, 3
Gene Name: PCDHGC3
Alternative Gene Name: PC-43, PC43, PCDH-GAMMA-C3, PCDH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102918: 98%, ENSRNOG00000019799: 95%
Entrez Gene ID: 5098
Uniprot ID: Q9UN70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDHGC3
Alternative Gene Name: PC-43, PC43, PCDH-GAMMA-C3, PCDH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102918: 98%, ENSRNOG00000019799: 95%
Entrez Gene ID: 5098
Uniprot ID: Q9UN70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAES |
Gene Sequence | YKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAES |
Gene ID - Mouse | ENSMUSG00000102918 |
Gene ID - Rat | ENSRNOG00000019799 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PCDHGC3 pAb (ATL-HPA077289) | |
Datasheet | Anti PCDHGC3 pAb (ATL-HPA077289) Datasheet (External Link) |
Vendor Page | Anti PCDHGC3 pAb (ATL-HPA077289) at Atlas Antibodies |
Documents & Links for Anti PCDHGC3 pAb (ATL-HPA077289) | |
Datasheet | Anti PCDHGC3 pAb (ATL-HPA077289) Datasheet (External Link) |
Vendor Page | Anti PCDHGC3 pAb (ATL-HPA077289) |