Protein Description: protocadherin gamma subfamily B, 2
Gene Name: PCDHGB2
Alternative Gene Name: PCDH-GAMMA-B2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102748: 71%, ENSRNOG00000039461: 55%
Entrez Gene ID: 56103
Uniprot ID: Q9Y5G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDHGB2
Alternative Gene Name: PCDH-GAMMA-B2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102748: 71%, ENSRNOG00000039461: 55%
Entrez Gene ID: 56103
Uniprot ID: Q9Y5G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDGRKYP |
| Documents & Links for Anti PCDHGB2 pAb (ATL-HPA077526) | |
| Datasheet | Anti PCDHGB2 pAb (ATL-HPA077526) Datasheet (External Link) |
| Vendor Page | Anti PCDHGB2 pAb (ATL-HPA077526) at Atlas |
| Documents & Links for Anti PCDHGB2 pAb (ATL-HPA077526) | |
| Datasheet | Anti PCDHGB2 pAb (ATL-HPA077526) Datasheet (External Link) |
| Vendor Page | Anti PCDHGB2 pAb (ATL-HPA077526) |