Description
Product Description
Protein Description: protocadherin gamma subfamily B, 2
Gene Name: PCDHGB2
Alternative Gene Name: PCDH-GAMMA-B2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102748: 71%, ENSRNOG00000039461: 55%
Entrez Gene ID: 56103
Uniprot ID: Q9Y5G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDHGB2
Alternative Gene Name: PCDH-GAMMA-B2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102748: 71%, ENSRNOG00000039461: 55%
Entrez Gene ID: 56103
Uniprot ID: Q9Y5G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDGRKYP |
Gene Sequence | PLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDGRKYP |
Gene ID - Mouse | ENSMUSG00000102748 |
Gene ID - Rat | ENSRNOG00000039461 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PCDHGB2 pAb (ATL-HPA077526) | |
Datasheet | Anti PCDHGB2 pAb (ATL-HPA077526) Datasheet (External Link) |
Vendor Page | Anti PCDHGB2 pAb (ATL-HPA077526) at Atlas Antibodies |
Documents & Links for Anti PCDHGB2 pAb (ATL-HPA077526) | |
Datasheet | Anti PCDHGB2 pAb (ATL-HPA077526) Datasheet (External Link) |
Vendor Page | Anti PCDHGB2 pAb (ATL-HPA077526) |