Anti PCDHGB2 pAb (ATL-HPA077526)

Atlas Antibodies

Catalog No: ATL-HPA077526-25

• 

Product Description

Protein Description: protocadherin gamma subfamily B, 2
Gene Name: PCDHGB2
Alternative Gene Name: PCDH-GAMMA-B2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102748: 71%, ENSRNOG00000039461: 55%
Entrez Gene ID: 56103
Uniprot ID: Q9Y5G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDGRKYP
• Gene Sequence: PLFKQTKINLKIGESTKPGTTFPLDPALDSDVGPNSLQRYHLNDNEYFDLAEKQTPDGRKYP
• Gene ID - Mouse: ENSMUSG00000102748
• Gene ID - Rat: ENSRNOG00000039461
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.