Anti PCDHGB1 pAb (ATL-HPA076182)

Atlas Antibodies

Catalog No: ATL-HPA076182-25

• 

Product Description

Protein Description: protocadherin gamma subfamily B, 1
Gene Name: PCDHGB1
Alternative Gene Name: PCDH-GAMMA-B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103037: 79%, ENSRNOG00000042264: 75%
Entrez Gene ID: 56104
Uniprot ID: Q9Y5G3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INAEITYAFLNSPISTSLFNLNPNTGDITTNGTLDFEETSRYVLSVEAKDG
• Gene Sequence: INAEITYAFLNSPISTSLFNLNPNTGDITTNGTLDFEETSRYVLSVEAKDG
• Gene ID - Mouse: ENSMUSG00000103037
• Gene ID - Rat: ENSRNOG00000042264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.