Protein Description: protocadherin gamma subfamily A, 10
Gene Name: PCDHGA10
Alternative Gene Name: PCDH-GAMMA-A10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102222: 86%, ENSRNOG00000027253: 80%
Entrez Gene ID: 56106
Uniprot ID: Q9Y5H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDHGA10
Alternative Gene Name: PCDH-GAMMA-A10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102222: 86%, ENSRNOG00000027253: 80%
Entrez Gene ID: 56106
Uniprot ID: Q9Y5H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RKLPDTQLLKFQLNKYTGEIKISENLDYEETGFYEIEIQAEDGGAYLATAK |
Documents & Links for Anti PCDHGA10 pAb (ATL-HPA077276) | |
Datasheet | Anti PCDHGA10 pAb (ATL-HPA077276) Datasheet (External Link) |
Vendor Page | Anti PCDHGA10 pAb (ATL-HPA077276) at Atlas |
Documents & Links for Anti PCDHGA10 pAb (ATL-HPA077276) | |
Datasheet | Anti PCDHGA10 pAb (ATL-HPA077276) Datasheet (External Link) |
Vendor Page | Anti PCDHGA10 pAb (ATL-HPA077276) |