Anti PCDHB8 pAb (ATL-HPA057773)

Atlas Antibodies

Catalog No: ATL-HPA057773-25

• 

Product Description

Protein Description: protocadherin beta 8
Gene Name: PCDHB8
Alternative Gene Name: PCDH-BETA8, PCDH3I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047910: 61%, ENSRNOG00000020059: 45%
Entrez Gene ID: 56128
Uniprot ID: Q9UN66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPVLPNIQGHSFGPEMEQNSNFRNGFGFSLQLK
• Gene Sequence: KPVLPNIQGHSFGPEMEQNSNFRNGFGFSLQLK
• Gene ID - Mouse: ENSMUSG00000047910
• Gene ID - Rat: ENSRNOG00000020059
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.