Description
Product Description
Protein Description: protocadherin beta 5
Gene Name: PCDHB5
Alternative Gene Name: DKFZp586B0217, PCDH-BETA5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045657: 78%, ENSRNOG00000020073: 72%
Entrez Gene ID: 26167
Uniprot ID: Q9Y5E4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDHB5
Alternative Gene Name: DKFZp586B0217, PCDH-BETA5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045657: 78%, ENSRNOG00000020073: 72%
Entrez Gene ID: 26167
Uniprot ID: Q9Y5E4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DAGAYGSVAYALFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIV |
Gene Sequence | DAGAYGSVAYALFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIV |
Gene ID - Mouse | ENSMUSG00000045657 |
Gene ID - Rat | ENSRNOG00000020073 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PCDHB5 pAb (ATL-HPA067473) | |
Datasheet | Anti PCDHB5 pAb (ATL-HPA067473) Datasheet (External Link) |
Vendor Page | Anti PCDHB5 pAb (ATL-HPA067473) at Atlas Antibodies |
Documents & Links for Anti PCDHB5 pAb (ATL-HPA067473) | |
Datasheet | Anti PCDHB5 pAb (ATL-HPA067473) Datasheet (External Link) |
Vendor Page | Anti PCDHB5 pAb (ATL-HPA067473) |