Anti PCDHB5 pAb (ATL-HPA067473)

Atlas Antibodies

Catalog No: ATL-HPA067473-25

• 

Product Description

Protein Description: protocadherin beta 5
Gene Name: PCDHB5
Alternative Gene Name: DKFZp586B0217, PCDH-BETA5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045657: 78%, ENSRNOG00000020073: 72%
Entrez Gene ID: 26167
Uniprot ID: Q9Y5E4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DAGAYGSVAYALFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIV
• Gene Sequence: DAGAYGSVAYALFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIV
• Gene ID - Mouse: ENSMUSG00000045657
• Gene ID - Rat: ENSRNOG00000020073
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.