Description
Product Description
Protein Description: protocadherin alpha subfamily C, 2
Gene Name: PCDHAC2
Alternative Gene Name: PCDH-ALPHA-C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102697: 91%, ENSRNOG00000020119: 92%
Entrez Gene ID: 56134
Uniprot ID: Q9Y5I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDHAC2
Alternative Gene Name: PCDH-ALPHA-C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102697: 91%, ENSRNOG00000020119: 92%
Entrez Gene ID: 56134
Uniprot ID: Q9Y5I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CGVRERSPAELYKQANNNIDARIPHGLKVQPHFIEVRGNGSLTKTYCYKACLTAGSGSDTFMFYNTGAQTGPGPSGAQAAVTDSRNLTGQSGQNAGNLII |
Gene Sequence | CGVRERSPAELYKQANNNIDARIPHGLKVQPHFIEVRGNGSLTKTYCYKACLTAGSGSDTFMFYNTGAQTGPGPSGAQAAVTDSRNLTGQSGQNAGNLII |
Gene ID - Mouse | ENSMUSG00000102697 |
Gene ID - Rat | ENSRNOG00000020119 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PCDHAC2 pAb (ATL-HPA076190) | |
Datasheet | Anti PCDHAC2 pAb (ATL-HPA076190) Datasheet (External Link) |
Vendor Page | Anti PCDHAC2 pAb (ATL-HPA076190) at Atlas Antibodies |
Documents & Links for Anti PCDHAC2 pAb (ATL-HPA076190) | |
Datasheet | Anti PCDHAC2 pAb (ATL-HPA076190) Datasheet (External Link) |
Vendor Page | Anti PCDHAC2 pAb (ATL-HPA076190) |