Description
Product Description
Protein Description: protocadherin alpha 12
Gene Name: PCDHA12
Alternative Gene Name: PCDH-ALPHA12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103707: 49%, ENSRNOG00000020119: 50%
Entrez Gene ID: 56137
Uniprot ID: Q9UN75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDHA12
Alternative Gene Name: PCDH-ALPHA12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103707: 49%, ENSRNOG00000020119: 50%
Entrez Gene ID: 56137
Uniprot ID: Q9UN75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV |
Gene Sequence | LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV |
Gene ID - Mouse | ENSMUSG00000103707 |
Gene ID - Rat | ENSRNOG00000020119 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PCDHA12 pAb (ATL-HPA035812) | |
Datasheet | Anti PCDHA12 pAb (ATL-HPA035812) Datasheet (External Link) |
Vendor Page | Anti PCDHA12 pAb (ATL-HPA035812) at Atlas Antibodies |
Documents & Links for Anti PCDHA12 pAb (ATL-HPA035812) | |
Datasheet | Anti PCDHA12 pAb (ATL-HPA035812) Datasheet (External Link) |
Vendor Page | Anti PCDHA12 pAb (ATL-HPA035812) |