Anti PCDHA12 pAb (ATL-HPA035812)

Catalog No:
ATL-HPA035812-25
$447.00

Description

Product Description

Protein Description: protocadherin alpha 12
Gene Name: PCDHA12
Alternative Gene Name: PCDH-ALPHA12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103707: 49%, ENSRNOG00000020119: 50%
Entrez Gene ID: 56137
Uniprot ID: Q9UN75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV
Gene Sequence LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV
Gene ID - Mouse ENSMUSG00000103707
Gene ID - Rat ENSRNOG00000020119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PCDHA12 pAb (ATL-HPA035812)
Datasheet Anti PCDHA12 pAb (ATL-HPA035812) Datasheet (External Link)
Vendor Page Anti PCDHA12 pAb (ATL-HPA035812) at Atlas Antibodies

Documents & Links for Anti PCDHA12 pAb (ATL-HPA035812)
Datasheet Anti PCDHA12 pAb (ATL-HPA035812) Datasheet (External Link)
Vendor Page Anti PCDHA12 pAb (ATL-HPA035812)

Product Description

Protein Description: protocadherin alpha 12
Gene Name: PCDHA12
Alternative Gene Name: PCDH-ALPHA12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103707: 49%, ENSRNOG00000020119: 50%
Entrez Gene ID: 56137
Uniprot ID: Q9UN75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV
Gene Sequence LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV
Gene ID - Mouse ENSMUSG00000103707
Gene ID - Rat ENSRNOG00000020119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PCDHA12 pAb (ATL-HPA035812)
Datasheet Anti PCDHA12 pAb (ATL-HPA035812) Datasheet (External Link)
Vendor Page Anti PCDHA12 pAb (ATL-HPA035812) at Atlas Antibodies

Documents & Links for Anti PCDHA12 pAb (ATL-HPA035812)
Datasheet Anti PCDHA12 pAb (ATL-HPA035812) Datasheet (External Link)
Vendor Page Anti PCDHA12 pAb (ATL-HPA035812)