Protein Description: protocadherin alpha 11
Gene Name: PCDHA11
Alternative Gene Name: CNR7, CNRN7, CNRS7, CRNR7, PCDH-ALPHA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102206: 79%, ENSRNOG00000020119: 81%
Entrez Gene ID: 56138
Uniprot ID: Q9Y5I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDHA11
Alternative Gene Name: CNR7, CNRN7, CNRS7, CRNR7, PCDH-ALPHA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102206: 79%, ENSRNOG00000020119: 81%
Entrez Gene ID: 56138
Uniprot ID: Q9Y5I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDK |
Documents & Links for Anti PCDHA11 pAb (ATL-HPA077160) | |
Datasheet | Anti PCDHA11 pAb (ATL-HPA077160) Datasheet (External Link) |
Vendor Page | Anti PCDHA11 pAb (ATL-HPA077160) at Atlas |
Documents & Links for Anti PCDHA11 pAb (ATL-HPA077160) | |
Datasheet | Anti PCDHA11 pAb (ATL-HPA077160) Datasheet (External Link) |
Vendor Page | Anti PCDHA11 pAb (ATL-HPA077160) |