Description
Product Description
Protein Description: protocadherin 20
Gene Name: PCDH20
Alternative Gene Name: FLJ22218, PCDH13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050505: 86%, ENSRNOG00000013306: 88%
Entrez Gene ID: 64881
Uniprot ID: Q8N6Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDH20
Alternative Gene Name: FLJ22218, PCDH13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050505: 86%, ENSRNOG00000013306: 88%
Entrez Gene ID: 64881
Uniprot ID: Q8N6Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFV |
Gene Sequence | GAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFV |
Gene ID - Mouse | ENSMUSG00000050505 |
Gene ID - Rat | ENSRNOG00000013306 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PCDH20 pAb (ATL-HPA062669) | |
Datasheet | Anti PCDH20 pAb (ATL-HPA062669) Datasheet (External Link) |
Vendor Page | Anti PCDH20 pAb (ATL-HPA062669) at Atlas Antibodies |
Documents & Links for Anti PCDH20 pAb (ATL-HPA062669) | |
Datasheet | Anti PCDH20 pAb (ATL-HPA062669) Datasheet (External Link) |
Vendor Page | Anti PCDH20 pAb (ATL-HPA062669) |