Protein Description: protocadherin 17
Gene Name: PCDH17
Alternative Gene Name: PCDH68, PCH68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035566: 100%, ENSRNOG00000008970: 100%
Entrez Gene ID: 27253
Uniprot ID: O14917
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDH17
Alternative Gene Name: PCDH68, PCH68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035566: 100%, ENSRNOG00000008970: 100%
Entrez Gene ID: 27253
Uniprot ID: O14917
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD |
Documents & Links for Anti PCDH17 pAb (ATL-HPA026817) | |
Datasheet | Anti PCDH17 pAb (ATL-HPA026817) Datasheet (External Link) |
Vendor Page | Anti PCDH17 pAb (ATL-HPA026817) at Atlas |
Documents & Links for Anti PCDH17 pAb (ATL-HPA026817) | |
Datasheet | Anti PCDH17 pAb (ATL-HPA026817) Datasheet (External Link) |
Vendor Page | Anti PCDH17 pAb (ATL-HPA026817) |
Citations for Anti PCDH17 pAb (ATL-HPA026817) – 3 Found |
Yin, Xuedong; Xiang, Tingxiu; Mu, Junhao; Mao, Haitao; Li, Lili; Huang, Xin; Li, Chunhong; Feng, Yixiao; Luo, Xinrong; Wei, Yuxian; Peng, Weiyan; Ren, Guosheng; Tao, Qian. Protocadherin 17 functions as a tumor suppressor suppressing Wnt/β-catenin signaling and cell metastasis and is frequently methylated in breast cancer. Oncotarget. 2016;7(32):51720-51732. PubMed |
Chen, Liuxi; Liu, Ying; Zhang, Qi; Zhang, Mingming; Han, Xuemeng; Li, Qiujie; Xie, Tian; Wu, Qibiao; Sui, Xinbing. p53/PCDH17/Beclin-1 Proteins as Prognostic Predictors for Urinary Bladder Cancer. Journal Of Cancer. 10(25):6207-6216. PubMed |
Liu, Shuiping; Lin, Haoming; Wang, Da; Li, Qiang; Luo, Hong; Li, Guoxiong; Chen, Xiaohui; Li, Yongqiang; Chen, Peng; Zhai, Bingtao; Wang, Wengang; Zhang, Ruonan; Chen, Bi; Zhang, Mingming; Han, Xuemeng; Li, Qiujie; Chen, Liuxi; Liu, Ying; Chen, Xiaying; Li, Guohua; Xiang, Yu; Duan, Ting; Feng, Jiao; Lou, Jianshu; Huang, Xingxing; Zhang, Qin; Pan, Ting; Yan, Lili; Jin, Ting; Zhang, Wenzheng; Zhuo, Lvjia; Sun, Yitian; Xie, Tian; Sui, Xinbing. PCDH17 increases the sensitivity of colorectal cancer to 5-fluorouracil treatment by inducing apoptosis and autophagic cell death. Signal Transduction And Targeted Therapy. 4( 31815010):53. PubMed |