Protein Description: protocadherin 11 X-linked
Gene Name: PCDH11X
Alternative Gene Name: PCDH-X, PCDH11, PCDHX, PPP1R119
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034755: 81%, ENSRNOG00000004118: 37%
Entrez Gene ID: 27328
Uniprot ID: Q9BZA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDH11X
Alternative Gene Name: PCDH-X, PCDH11, PCDHX, PPP1R119
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034755: 81%, ENSRNOG00000004118: 37%
Entrez Gene ID: 27328
Uniprot ID: Q9BZA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PVSVHTRPPMKEVVRSCTPMKESTTMEIWIHPQPQRKSEGKVAGKSQRRVTF |
| Documents & Links for Anti PCDH11X pAb (ATL-HPA077495) | |
| Datasheet | Anti PCDH11X pAb (ATL-HPA077495) Datasheet (External Link) |
| Vendor Page | Anti PCDH11X pAb (ATL-HPA077495) at Atlas |
| Documents & Links for Anti PCDH11X pAb (ATL-HPA077495) | |
| Datasheet | Anti PCDH11X pAb (ATL-HPA077495) Datasheet (External Link) |
| Vendor Page | Anti PCDH11X pAb (ATL-HPA077495) |