Anti PCDH10 pAb (ATL-HPA073462)

Catalog No:
ATL-HPA073462-25
$447.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Description

Product Description

Protein Description: protocadherin 10
Gene Name: PCDH10
Alternative Gene Name: KIAA1400, OL-PCDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049100: 94%, ENSRNOG00000031974: 94%
Entrez Gene ID: 57575
Uniprot ID: Q9P2E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNT
Gene Sequence MPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNT
Gene ID - Mouse ENSMUSG00000049100
Gene ID - Rat ENSRNOG00000031974
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PCDH10 pAb (ATL-HPA073462)
Datasheet Anti PCDH10 pAb (ATL-HPA073462) Datasheet (External Link)
Vendor Page Anti PCDH10 pAb (ATL-HPA073462) at Atlas Antibodies

Documents & Links for Anti PCDH10 pAb (ATL-HPA073462)
Datasheet Anti PCDH10 pAb (ATL-HPA073462) Datasheet (External Link)
Vendor Page Anti PCDH10 pAb (ATL-HPA073462)

Product Description

Protein Description: protocadherin 10
Gene Name: PCDH10
Alternative Gene Name: KIAA1400, OL-PCDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049100: 94%, ENSRNOG00000031974: 94%
Entrez Gene ID: 57575
Uniprot ID: Q9P2E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNT
Gene Sequence MPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNT
Gene ID - Mouse ENSMUSG00000049100
Gene ID - Rat ENSRNOG00000031974
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PCDH10 pAb (ATL-HPA073462)
Datasheet Anti PCDH10 pAb (ATL-HPA073462) Datasheet (External Link)
Vendor Page Anti PCDH10 pAb (ATL-HPA073462) at Atlas Antibodies

Documents & Links for Anti PCDH10 pAb (ATL-HPA073462)
Datasheet Anti PCDH10 pAb (ATL-HPA073462) Datasheet (External Link)
Vendor Page Anti PCDH10 pAb (ATL-HPA073462)