Protein Description: protocadherin 10
Gene Name: PCDH10
Alternative Gene Name: KIAA1400, OL-PCDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049100: 94%, ENSRNOG00000031974: 94%
Entrez Gene ID: 57575
Uniprot ID: Q9P2E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCDH10
Alternative Gene Name: KIAA1400, OL-PCDH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049100: 94%, ENSRNOG00000031974: 94%
Entrez Gene ID: 57575
Uniprot ID: Q9P2E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSFSTFGKEKALHSTLERKELDGLLTNT |
Documents & Links for Anti PCDH10 pAb (ATL-HPA073462) | |
Datasheet | Anti PCDH10 pAb (ATL-HPA073462) Datasheet (External Link) |
Vendor Page | Anti PCDH10 pAb (ATL-HPA073462) at Atlas |
Documents & Links for Anti PCDH10 pAb (ATL-HPA073462) | |
Datasheet | Anti PCDH10 pAb (ATL-HPA073462) Datasheet (External Link) |
Vendor Page | Anti PCDH10 pAb (ATL-HPA073462) |