Description
Product Description
Protein Description: poly(rC) binding protein 4
Gene Name: PCBP4
Alternative Gene Name: LIP4, MCG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023495: 96%, ENSRNOG00000012406: 96%
Entrez Gene ID: 57060
Uniprot ID: P57723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCBP4
Alternative Gene Name: LIP4, MCG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023495: 96%, ENSRNOG00000012406: 96%
Entrez Gene ID: 57060
Uniprot ID: P57723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP |
Gene Sequence | ATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP |
Gene ID - Mouse | ENSMUSG00000023495 |
Gene ID - Rat | ENSRNOG00000012406 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PCBP4 pAb (ATL-HPA057754) | |
Datasheet | Anti PCBP4 pAb (ATL-HPA057754) Datasheet (External Link) |
Vendor Page | Anti PCBP4 pAb (ATL-HPA057754) at Atlas Antibodies |
Documents & Links for Anti PCBP4 pAb (ATL-HPA057754) | |
Datasheet | Anti PCBP4 pAb (ATL-HPA057754) Datasheet (External Link) |
Vendor Page | Anti PCBP4 pAb (ATL-HPA057754) |