Anti PCBP4 pAb (ATL-HPA057754)

Atlas Antibodies

Catalog No: ATL-HPA057754-100

• 
• 

Product Description

Protein Description: poly(rC) binding protein 4
Gene Name: PCBP4
Alternative Gene Name: LIP4, MCG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023495: 96%, ENSRNOG00000012406: 96%
Entrez Gene ID: 57060
Uniprot ID: P57723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP
• Gene Sequence: ATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP
• Gene ID - Mouse: ENSMUSG00000023495
• Gene ID - Rat: ENSRNOG00000012406
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.