Anti PAX8 pAb (ATL-HPA064554)

Catalog No:
ATL-HPA064554-25
$395.00

Description

Product Description

Protein Description: paired box 8
Gene Name: PAX8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026976: 90%, ENSRNOG00000026203: 88%
Entrez Gene ID: 7849
Uniprot ID: Q06710
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGY
Gene Sequence SLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGY
Gene ID - Mouse ENSMUSG00000026976
Gene ID - Rat ENSRNOG00000026203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PAX8 pAb (ATL-HPA064554)
Datasheet Anti PAX8 pAb (ATL-HPA064554) Datasheet (External Link)
Vendor Page Anti PAX8 pAb (ATL-HPA064554) at Atlas Antibodies

Documents & Links for Anti PAX8 pAb (ATL-HPA064554)
Datasheet Anti PAX8 pAb (ATL-HPA064554) Datasheet (External Link)
Vendor Page Anti PAX8 pAb (ATL-HPA064554)

Product Description

Protein Description: paired box 8
Gene Name: PAX8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026976: 90%, ENSRNOG00000026203: 88%
Entrez Gene ID: 7849
Uniprot ID: Q06710
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGY
Gene Sequence SLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGY
Gene ID - Mouse ENSMUSG00000026976
Gene ID - Rat ENSRNOG00000026203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PAX8 pAb (ATL-HPA064554)
Datasheet Anti PAX8 pAb (ATL-HPA064554) Datasheet (External Link)
Vendor Page Anti PAX8 pAb (ATL-HPA064554) at Atlas Antibodies

Documents & Links for Anti PAX8 pAb (ATL-HPA064554)
Datasheet Anti PAX8 pAb (ATL-HPA064554) Datasheet (External Link)
Vendor Page Anti PAX8 pAb (ATL-HPA064554)