Anti PAX3 pAb (ATL-HPA069000)

Atlas Antibodies

Catalog No: ATL-HPA069000-25

• 

Product Description

Protein Description: paired box 3
Gene Name: PAX3
Alternative Gene Name: HUP2, WS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004872: 98%, ENSRNOG00000013670: 98%
Entrez Gene ID: 5077
Uniprot ID: P23760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPS
• Gene Sequence: PPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPS
• Gene ID - Mouse: ENSMUSG00000004872
• Gene ID - Rat: ENSRNOG00000013670
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.