Protein Description: paired box 3
Gene Name: PAX3
Alternative Gene Name: HUP2, WS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004872: 98%, ENSRNOG00000013670: 98%
Entrez Gene ID: 5077
Uniprot ID: P23760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PAX3
Alternative Gene Name: HUP2, WS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004872: 98%, ENSRNOG00000013670: 98%
Entrez Gene ID: 5077
Uniprot ID: P23760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPS |
| Documents & Links for Anti PAX3 pAb (ATL-HPA069000) | |
| Datasheet | Anti PAX3 pAb (ATL-HPA069000) Datasheet (External Link) |
| Vendor Page | Anti PAX3 pAb (ATL-HPA069000) at Atlas |
| Documents & Links for Anti PAX3 pAb (ATL-HPA069000) | |
| Datasheet | Anti PAX3 pAb (ATL-HPA069000) Datasheet (External Link) |
| Vendor Page | Anti PAX3 pAb (ATL-HPA069000) |