Anti PATJ pAb (ATL-HPA069079)

Catalog No:
ATL-HPA069079-25
$447.00

Description

Product Description

Protein Description: PATJ, crumbs cell polarity complex component
Gene Name: PATJ
Alternative Gene Name: Cipp, INADL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061859: 89%, ENSRNOG00000007551: 83%
Entrez Gene ID: 10207
Uniprot ID: Q8NI35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSI
Gene Sequence NDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSI
Gene ID - Mouse ENSMUSG00000061859
Gene ID - Rat ENSRNOG00000007551
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PATJ pAb (ATL-HPA069079)
Datasheet Anti PATJ pAb (ATL-HPA069079) Datasheet (External Link)
Vendor Page Anti PATJ pAb (ATL-HPA069079) at Atlas Antibodies

Documents & Links for Anti PATJ pAb (ATL-HPA069079)
Datasheet Anti PATJ pAb (ATL-HPA069079) Datasheet (External Link)
Vendor Page Anti PATJ pAb (ATL-HPA069079)

Product Description

Protein Description: PATJ, crumbs cell polarity complex component
Gene Name: PATJ
Alternative Gene Name: Cipp, INADL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061859: 89%, ENSRNOG00000007551: 83%
Entrez Gene ID: 10207
Uniprot ID: Q8NI35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSI
Gene Sequence NDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSI
Gene ID - Mouse ENSMUSG00000061859
Gene ID - Rat ENSRNOG00000007551
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PATJ pAb (ATL-HPA069079)
Datasheet Anti PATJ pAb (ATL-HPA069079) Datasheet (External Link)
Vendor Page Anti PATJ pAb (ATL-HPA069079) at Atlas Antibodies

Documents & Links for Anti PATJ pAb (ATL-HPA069079)
Datasheet Anti PATJ pAb (ATL-HPA069079) Datasheet (External Link)
Vendor Page Anti PATJ pAb (ATL-HPA069079)