Protein Description: PATJ, crumbs cell polarity complex component
Gene Name: PATJ
Alternative Gene Name: Cipp, INADL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061859: 87%, ENSRNOG00000007551: 87%
Entrez Gene ID: 10207
Uniprot ID: Q8NI35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PATJ
Alternative Gene Name: Cipp, INADL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061859: 87%, ENSRNOG00000007551: 87%
Entrez Gene ID: 10207
Uniprot ID: Q8NI35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETEVDHNMDVNTEEDDDGELALWSPEVKIVELVKDCKG |
| Documents & Links for Anti PATJ pAb (ATL-HPA066960) | |
| Datasheet | Anti PATJ pAb (ATL-HPA066960) Datasheet (External Link) |
| Vendor Page | Anti PATJ pAb (ATL-HPA066960) at Atlas |
| Documents & Links for Anti PATJ pAb (ATL-HPA066960) | |
| Datasheet | Anti PATJ pAb (ATL-HPA066960) Datasheet (External Link) |
| Vendor Page | Anti PATJ pAb (ATL-HPA066960) |