Protein Description: PATJ, crumbs cell polarity complex component
Gene Name: PATJ
Alternative Gene Name: Cipp, INADL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061859: 81%, ENSRNOG00000007551: 82%
Entrez Gene ID: 10207
Uniprot ID: Q8NI35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PATJ
Alternative Gene Name: Cipp, INADL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061859: 81%, ENSRNOG00000007551: 82%
Entrez Gene ID: 10207
Uniprot ID: Q8NI35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEI |
| Documents & Links for Anti PATJ pAb (ATL-HPA066352) | |
| Datasheet | Anti PATJ pAb (ATL-HPA066352) Datasheet (External Link) |
| Vendor Page | Anti PATJ pAb (ATL-HPA066352) at Atlas |
| Documents & Links for Anti PATJ pAb (ATL-HPA066352) | |
| Datasheet | Anti PATJ pAb (ATL-HPA066352) Datasheet (External Link) |
| Vendor Page | Anti PATJ pAb (ATL-HPA066352) |
| Citations for Anti PATJ pAb (ATL-HPA066352) – 1 Found |
| Li, Pingping; Lan, Ping; Liu, Sheng; Wang, Yaochun; Liu, Peijun. Cell Polarity Protein Pals1-Associated Tight Junction Expression Is a Favorable Prognostic Marker in Clear Cell Renal Cell Carcinoma. Frontiers In Genetics. 11( 33005169):931. PubMed |