Anti PATJ pAb (ATL-HPA066352)

Atlas Antibodies

Catalog No: ATL-HPA066352-25

• 

Product Description

Protein Description: PATJ, crumbs cell polarity complex component
Gene Name: PATJ
Alternative Gene Name: Cipp, INADL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061859: 81%, ENSRNOG00000007551: 82%
Entrez Gene ID: 10207
Uniprot ID: Q8NI35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEI
• Gene Sequence: ATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEI
• Gene ID - Mouse: ENSMUSG00000061859
• Gene ID - Rat: ENSRNOG00000007551
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti PATJ pAb (ATL-HPA066352) – 1 Found

Li, Pingping; Lan, Ping; Liu, Sheng; Wang, Yaochun; Liu, Peijun. Cell Polarity Protein Pals1-Associated Tight Junction Expression Is a Favorable Prognostic Marker in Clear Cell Renal Cell Carcinoma. Frontiers In Genetics. 11( 33005169):931.