Protein Description: prostate and testis expressed 1
Gene Name: PATE1
Alternative Gene Name: PATE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091215: 58%, ENSRNOG00000049600: 56%
Entrez Gene ID: 160065
Uniprot ID: Q8WXA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PATE1
Alternative Gene Name: PATE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091215: 58%, ENSRNOG00000049600: 56%
Entrez Gene ID: 160065
Uniprot ID: Q8WXA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSGSLSMRNDAVNEIVAVKNNFPVIEIVRCRMCHLQFPGEKCSRGRGICTATTEE |
| Documents & Links for Anti PATE1 pAb (ATL-HPA076587) | |
| Datasheet | Anti PATE1 pAb (ATL-HPA076587) Datasheet (External Link) |
| Vendor Page | Anti PATE1 pAb (ATL-HPA076587) at Atlas |
| Documents & Links for Anti PATE1 pAb (ATL-HPA076587) | |
| Datasheet | Anti PATE1 pAb (ATL-HPA076587) Datasheet (External Link) |
| Vendor Page | Anti PATE1 pAb (ATL-HPA076587) |